SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1h28_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1h28_C
Domain Number 1 Region: 5-297
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.03e-107
Family Protein kinases, catalytic subunit 0.000000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1h28_C
Sequence length 303
Comment mol:protein length:303 CELL DIVISION PROTEIN KINASE 2
Sequence
gplgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisll
kelnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgl
afchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeill
gckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpd
ykpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvph
lrl
Download sequence
Identical sequences 1h1p_A 1h1p_C 1h1q_A 1h1q_C 1h1r_A 1h1r_C 1h1s_A 1h1s_C 1h24_A 1h24_C 1h25_A 1h25_C 1h26_A 1h26_C 1h27_A 1h27_C 1h28_A 1h28_C 2wma_A 2wma_C 2wmb_A 2wmb_C 4cfm_A 4cfm_C 4cfw_A 4cfw_C 4cfx_A 4cfx_C 5cyi_A 5cyi_C 5nev_A 5nev_C 5oo0_A 5osj_A 1h1pA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]