SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1h80_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1h80_A
Domain Number 1 Region: 5-462
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.23e-58
Family iota-carrageenase 0.0000000000000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1h80_A
Sequence length 464
Comment mol:protein length:464 IOTA-CARRAGEENASE
Sequence
vspktykdadfyvaptqqdvnydlvddfgangndtsddsnalqrainaisrkpnggtlli
pngtyhflgiqmksnvhirvesdviikptwngdgknhrlfevgvnnivrnfsfqglgngf
lvdfkdsrdknlavfklgdvrnykisnftiddnktifasilvdvterngrlhwsrngiie
rikqnnalfgygliqtygadnilfrnlhseggialrmetdnllmknykqggirnifadni
rcskglaavmfgphfmkngdvqvtnvssvscgsavrsdsgfvelfsptdevhtrqswkqa
vesklgrgcaqtpyargnggtrwaarvtqkdacldkakleygiepgsfgtvkvfdvtarf
gynadlkqdqldyfstsnpmckrvclptkeqwskqgqiyigpslaavidttpetskydyd
vktfnvkrinfpvnshktidtntessrvcnyygmsecsssrwer
Download sequence
Identical sequences 1h80_A 1h80_B 1ktw_A 1ktw_B 000081100|e1ktwB1|207.2.1.28|B:1-464 000081102|e1ktwA1|207.2.1.28|A:1-464 cath|current|1h80A00/28-491 cath|current|1h80B00/28-491 cath|current|1ktwA00/28-491 cath|current|1ktwB00/28-491 d1h80a_ d1h80b_ d1ktwa_ d1ktwb_ 1h80A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]