SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1i1a_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1i1a_C
Domain Number 1 Region: 125-215
Classification Level Classification E-value
Superfamily Immunoglobulin 2.71e-27
Family C1 set domains (antibody constant domain-like) 0.0000154
Further Details:      
 
Domain Number 2 Region: 17-118
Classification Level Classification E-value
Superfamily Immunoglobulin 4.76e-21
Family C1 set domains (antibody constant domain-like) 0.00000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1i1a_C
Sequence length 225
Comment mol:protein length:225 IG GAMMA-2A CHAIN C REGION
Sequence
vprecnpcgctgsevssvfifppktkdvltitltpkvtcvvvdisqndpevrfswfiddv
evhtaqthapekqsnstlrsvselpivhrdwlngktfkckvnsgafpapieksiskpegt
prgpqvytmappkeemtqsqvsitcmvkgfyppdiytewkmngqpqenykntpptmdtdg
syflysklnvkketwqqgntftcsvlheglhnhhtekslshspgk
Download sequence
Identical sequences 1i1aC 1i1a_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]