SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ieb_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ieb_C
Domain Number 1 Region: 5-81
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 5.17e-44
Family MHC antigen-recognition domain 0.00022
Further Details:      
 
Domain Number 2 Region: 85-180
Classification Level Classification E-value
Superfamily Immunoglobulin 3.39e-24
Family C1 set domains (antibody constant domain-like) 0.00000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1ieb_C
Sequence length 192
Comment mol:protein length:192 MHC CLASS II I-EK
Sequence
ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
eektllpetken
Download sequence
Identical sequences 1ieaA 1iea_A 1iea_C 1ieb_A 1ieb_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]