SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1irj_H from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1irj_H
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily EF-hand 1.34e-23
Family S100 proteins 0.0000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1irj_H
Sequence length 113
Comment mol:protein length:113 Migration Inhibitory Factor-Related Protein 14
Sequence
tckmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvieh
imedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
Download sequence
Identical sequences 1irj_A 1irj_B 1irj_C 1irj_D 1irj_E 1irj_F 1irj_G 1irj_H 1irjA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]