SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1jrg_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1jrg_B
Domain Number 1 Region: 6-360
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.04e-90
Family Pectate lyase-like 0.000000000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1jrg_B
Sequence length 361
Comment mol:protein length:361 Pectate lyase
Sequence
aelvsdkalesaptvgwasqngfttggaaatsdniyivtniseftsalsagaeakiiqik
gtidisggtpytdfadqkarsqinipanttviglgtdakfingsliidgtdgtnnviirn
vyiqtpidvephyekgdgwnaewdamnitngahhvwidhvtisdgnftddmyttkdgety
vqhdgaldikrgsdyvtisnslidqhdktmlighndtnsaqdkgklhvtlfnnvfnrvte
raprvrygsihsfnnvfkgdakdpvyryqysfgigtsgsvlsegnsftianlsaskackv
vkkfngsifsdngsvlngsavdlsgcgfsaytskipyiydvqpmttelaqsitdnagsgk
l
Download sequence
Identical sequences 1jtaA 000081072|e1jrgB1|207.2.1.15|B:1-361 000081073|e1jrgA1|207.2.1.15|A:1-361 000081076|e1jtaA1|207.2.1.15|A:1-361 cath|current|1jrgA00/1-361 cath|current|1jrgB00/1-361 cath|current|1jtaA00/1-361 d1jrga_ d1jrgb_ d1jtaa_ 1jrg_A 1jrg_B 1jta_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]