SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1kc5_H from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1kc5_H
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily Immunoglobulin 4.15e-46
Family V set domains (antibody variable domain-like) 0.0000045
Further Details:      
 
Domain Number 2 Region: 120-215
Classification Level Classification E-value
Superfamily Immunoglobulin 2.67e-25
Family C1 set domains (antibody constant domain-like) 0.000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1kc5_H
Sequence length 217
Comment mol:protein length:217 PC287 Immunoglobulin
Sequence
qvklqqsgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmayisysgstty
npslksrisitrdtsknqfflqlnsvttedtaiyycarggtgfdywgagttltvsaaatt
ppsvyplapgsataaasmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsdlytl
sssvtvpsspwpsetvtcnvahpasstkvdkkivprd
Download sequence
Identical sequences 1kc5_H 1kcu_H 1kcuH

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]