SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1kxt_F from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1kxt_F
Domain Number 1 Region: 1-127
Classification Level Classification E-value
Superfamily Immunoglobulin 4.56e-49
Family V set domains (antibody variable domain-like) 0.000000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1kxt_F
Sequence length 127
Comment mol:protein length:127 IMMUNOGLOBULIN VHH FRAGMENT
Sequence
qvqlvasgggsvqaggslrlscaasgytfssypmgwyrqapgkecelsarifsdgsanya
dsvkgrftisrdnaantaylqmdslkpedtavyycaagpgsgklvvagrtcygpnywgqg
tqvtvss
Download sequence
Identical sequences cath|current|1kxtB00/1-111 cath|current|1kxtD00/1-111 cath|current|1kxtF00/1-111 1kxt_B 1kxt_D 1kxt_F 1kxtB

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]