SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1loc_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1loc_A
Domain Number 1 Region: 6-181
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.28e-60
Family Legume lectins 0.00000768
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1loc_A
Sequence length 181
Comment mol:protein length:181 LEGUME ISOLECTIN I (ALPHA CHAIN)
Sequence
tettsfsitkfgpdqqnlifqgdgyttkerltltkavrntvgralysspihiwdsktgnv
anfvtsftfvidapnsynvadgftffiapvdtkpqtgggylgvfnskdydktsqtvavef
dtfyntawdpsngdrhigidvnsiksintkswalqngkeanvviafnaatnvltvsltyp
n
Download sequence
Identical sequences 1loeA cath|current|1loaA00/1-180 cath|current|1loaC00/1-180 cath|current|1loaE00/1-180 cath|current|1loaG00/1-180 cath|current|1lobA00/1-180 cath|current|1lobC00/1-180 cath|current|1lobE00/1-180 cath|current|1lobG00/1-180 cath|current|1locA00/1-180 cath|current|1locC00/1-180 cath|current|1locE00/1-180 cath|current|1locG00/1-180 cath|current|1lodA00/1-180 cath|current|1lodC00/1-180 cath|current|1lodE00/1-180 cath|current|1lodG00/1-180 cath|current|1loeA00/1-180 cath|current|1loeC00/1-181 cath|current|1lofA00/1-181 cath|current|1logA00/1-180 cath|current|1logC00/1-181 1loa_A 1loa_C 1loa_E 1loa_G 1lob_A 1lob_C 1lob_E 1lob_G 1loc_A 1loc_C 1loc_E 1loc_G 1lod_A 1lod_C 1lod_E 1lod_G 1loe_A 1loe_C 1lof_A 1log_A 1log_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]