SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1mtc_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1mtc_B
Domain Number 1 Region: 85-216
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.66e-46
Family Glutathione S-transferase (GST), C-terminal domain 0.00042
Further Details:      
 
Domain Number 2 Region: 2-83
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.65e-36
Family Glutathione S-transferase (GST), N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1mtc_B
Sequence length 217
Comment mol:protein length:217 Glutathione S-transferase YB1
Sequence
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhhlcgeteeeriradivenqvmdnrmqlimlcfnpdfe
kqkpeflktipekmklyseflgkrpwfagdkvtyvdflaydildqyhifepkcldafpnl
kdflarfeglkkisaymkssrylstpifsklaqwsnk
Download sequence
Identical sequences 1mtc_A 1mtc_B 1mtcA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]