SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ncx_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ncx_A
Domain Number 1 Region: 14-158
Classification Level Classification E-value
Superfamily EF-hand 1.45e-60
Family Calmodulin-like 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1ncx_A
Sequence length 162
Comment mol:protein length:162 TROPONIN C
Sequence
asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
iieevdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelge
ilratgehvteediedlmkdsdknndgridfdeflkmmegvq
Download sequence
Identical sequences 1topA d1ncxa_ d1ncya_ d1ncza_ d1topa_ 1ncx_A 1ncy_A 1ncz_A 1top_A 1ytz_C 1yv0_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]