SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ned_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ned_B
Domain Number 1 Region: 1-169
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.34e-69
Family Proteasome subunits 0.00000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1ned_B
Sequence length 183
Comment mol:protein length:183 HSLV
Sequence
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsykaefhhh
hhh
Download sequence
Identical sequences cath|current|1nedA00/1-187 cath|current|1nedB00/1-188 cath|current|1nedC00/1-188 1nedA 1ned_A 1ned_B 1ned_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]