SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1o8m_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1o8m_A
Domain Number 1 Region: 3-347
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.25e-86
Family Pectate lyase-like 0.000000000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1o8m_A
Sequence length 353
Comment mol:protein length:353 PECTATE LYASE C
Sequence
atdtggyaataggnvtgavsktatsmqdivniidaarldangkkvkggayplvitytgne
dslinaaaanicgqwskdprgveikeftkgitiigangssanfgiwikkssdvvvqnmri
gylpggakdgdmirvddspnvwvdhnelfaanhecdgtpdndttfesavdikgasntvtv
synyihgvkkvgldgssssdtgrnityhhnyyndvnarlplqrgglvhaynnlytnitgs
glnvrqngqaliennwfekainpvtsrydgknfgtwvlkgnnitkpadfstysitwtadt
kpyvnadswtstgtfptvaynyspvsaqcvkdklpgyagvgknlatltstack
Download sequence
Identical sequences 1air_A 1o88_A 1o8d_A 1o8e_A 1o8f_A 1o8g_A 1o8h_A 1o8i_A 1o8j_A 1o8k_A 1o8l_A 1o8m_A 1plu_A 2pec_A 000007208|e1o88A1|207.2.1.15|A:1-353 000081059|e1o8fA1|207.2.1.15|A:1-353 000081060|e1o8jA1|207.2.1.15|A:1-353 000081061|e1o8kA1|207.2.1.15|A:1-353 000081062|e1o8mA1|207.2.1.15|A:1-353 000081063|e1o8hA1|207.2.1.15|A:1-353 000081065|e1pluA1|207.2.1.15|A:1-353 000081066|e1o8dA1|207.2.1.15|A:1-353 000081068|e1o8eA1|207.2.1.15|A:1-353 000081069|e1o8lA1|207.2.1.15|A:1-353 000081070|e1o8iA1|207.2.1.15|A:1-353 000081071|e1o8gA1|207.2.1.15|A:1-353 cath|current|1airA00/1-352 cath|current|1o88A00/1-353 cath|current|1o8dA00/1-353 cath|current|1o8eA00/1-353 cath|current|1o8fA00/1-353 cath|current|1o8gA00/1-353 cath|current|1o8hA00/1-353 cath|current|1o8iA00/1-353 cath|current|1o8jA00/1-353 cath|current|1o8kA00/1-353 cath|current|1o8lA00/1-353 cath|current|1o8mA00/1-353 cath|current|1pluA00/1-353 cath|current|2pecA00/1-352 d1o88a_ d1o8da_ d1o8ea_ d1o8fa_ d1o8ga_ d1o8ha_ d1o8ia_ d1o8ja_ d1o8ka_ d1o8la_ d1o8ma_ d1plua_ 1o88A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]