SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1p2c_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1p2c_A
Domain Number 1 Region: 3-106
Classification Level Classification E-value
Superfamily Immunoglobulin 2.9e-37
Family V set domains (antibody variable domain-like) 0.0000138
Further Details:      
 
Domain Number 2 Region: 111-211
Classification Level Classification E-value
Superfamily Immunoglobulin 7.56e-28
Family C1 set domains (antibody constant domain-like) 0.0000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1p2c_A
Sequence length 212
Comment mol:protein length:212 light chain anti-lysozyme antibody F10.6.6
Sequence
dieltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikytsqsmsgips
rfsgsgsgtdftlsinsvetedfgvyfcqqsgswprtfgggtkldikradaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnrn
Download sequence
Identical sequences 1p2cA 1p2c_A 1p2c_D 2q76_A 2q76_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]