SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1pl2_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1pl2_B
Domain Number 1 Region: 81-211
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.01e-45
Family Glutathione S-transferase (GST), C-terminal domain 0.0000527
Further Details:      
 
Domain Number 2 Region: 6-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.53e-29
Family Glutathione S-transferase (GST), N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1pl2_B
Sequence length 222
Comment mol:protein length:222 Glutathione S-transferase A1
Sequence
maekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
dgmklvqerailnyiaskynlygkdikeralidmyiegiadlgemilllpvcppeekdak
lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
lkalktrisnlptvkkflqpgsprkppmdeksleearkifrf
Download sequence
Identical sequences 1pl2A 1pl2_A 1pl2_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]