SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qdv_D from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qdv_D
Domain Number 1 Region: 3-99
Classification Level Classification E-value
Superfamily POZ domain 6.33e-42
Family Tetramerization domain of potassium channels 0.0000078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1qdv_D
Sequence length 99
Comment mol:protein length:99 KV1.2 VOLTAGE-GATED POTASSIUM CHANNEL
Sequence
ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
qsggrlrrpvnvpldifseeirfyelgeeamemfredeg
Download sequence
Identical sequences 000072883|e1qdvA1|226.1.1.2|A:1-99 000072891|e1qdvD1|226.1.1.2|D:1-99 000072897|e1qdvC1|226.1.1.2|C:1-99 000072900|e1qdvB1|226.1.1.2|B:1-99 cath|current|1qdvA00/33-131 cath|current|1qdvB00/33-131 cath|current|1qdvC00/33-131 cath|current|1qdvD00/33-131 d1qdva_ d1qdvb_ d1qdvc_ d1qdvd_ 1qdvA 1qdv_A 1qdv_B 1qdv_C 1qdv_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]