SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qnz_L from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qnz_L
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily Immunoglobulin 3.92e-40
Family V set domains (antibody variable domain-like) 0.0000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1qnz_L
Sequence length 112
Comment mol:protein length:112 0.5B ANTIBODY (LIGHT CHAIN)
Sequence
divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyaasnles
giparfsgsgsrtdftlnihpveeedaatyycqqsnedpftfgsgtkleikr
Download sequence
Identical sequences cath|current|1qnzL00/1-112 1qnzL 1qnz_L

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]