SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1qzg_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1qzg_A
Domain Number 1 Region: 8-174
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.74e-40
Family Single strand DNA-binding domain, SSB 0.0000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1qzg_A
Sequence length 187
Comment mol:protein length:187 Protection of telomeres protein 1
Sequence
gpggedvidslqlnellnageykigeltfqsirssqelqkkntivnlfgivkdftpsrqs
lhgtkdwvttvylwdptcdtssiglqihlfskqgndlpvikqvgqplllhqitlrsyrdr
tqglskdqfryalwpdfssnskdtlcpqpmprlmktgdkeeqfalllnkiwdeqtnkhkn
gellsts
Download sequence
Identical sequences 1qzg_A 1qzg_B 1qzh_A 1qzh_B 1qzh_C 1qzh_D 1qzh_E 1qzh_F cath|current|1qzgA00/5-174 cath|current|1qzgB00/5-174 cath|current|1qzhA00/5-174 cath|current|1qzhB00/5-174 cath|current|1qzhC00/5-174 cath|current|1qzhD00/5-174 cath|current|1qzhE00/5-174 cath|current|1qzhF00/5-174 1qzgA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]