SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1rk9_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1rk9_A
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily EF-hand 4.91e-24
Family Parvalbumin 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1rk9_A
Sequence length 110
Comment mol:protein length:110 Parvalbumin alpha
Sequence
MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIE
EDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES
Download sequence
Identical sequences A0A024R1K9 P20472
NP_001302461.1.87134 NP_001302461.1.92137 NP_002845.1.87134 NP_002845.1.92137 ENSP00000216200 1rjvA gi|4506335|ref|NP_002845.1| ENSP00000216200 ENSP00000400247 ENSP00000480913 CIRMMP07 cath|current|1rjvA00/1-110 cath|current|1rk9A00/1-110 d1rjva_ d1rk9a_ 1rjv_A 1rk9_A 9606.ENSP00000216200 ENSP00000216200 ENSP00000400247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]