SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1t2v_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1t2v_C
Domain Number 1 Region: 5-111
Classification Level Classification E-value
Superfamily BRCT domain 3.95e-28
Family BRCT domain 0.00000162
Further Details:      
 
Domain Number 2 Region: 114-212
Classification Level Classification E-value
Superfamily BRCT domain 5.27e-25
Family BRCT domain 0.00000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1t2v_C
Sequence length 214
Comment mol:protein length:214 Breast cancer type 1 susceptibility protein
Sequence
vnkrmsmvvsgltpeefmlvykfarkhhitltnliteetthvvmktdaefvcertlkyfl
giaggkwvvsyfwvtqsikerkmlnehdfevrgdvvngrnhqgpkraresqdrkifrgle
iccygpftnmptdqlewmvqlcgasvvkelssftlgtgvhpivvvqpdawtedngfhaig
qmceapvvtrewvldsvalyqcqeldtylipqip
Download sequence
Identical sequences 1t15A 1jnx_X 1t15_A 1t29_A 1t2v_A 1t2v_B 1t2v_C 1t2v_D 1t2v_E 1y98_A 4ifi_A 4igk_A 4igk_B 4ofb_A 4u4a_A 4u4a_B 4u4a_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]