SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1ulg_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1ulg_B
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.72e-26
Family Galectin (animal S-lectin) 0.000000511
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1ulg_B
Sequence length 150
Comment mol:protein length:150 galectin-2
Sequence
MLYHLFVNNQVKLQNDFKPESVAAIRSSAFNSKGGTTVFNFLSAGENILLHISIRPGENV
IVFNSRLKNGAWGPEERIPYAEKFRPPNPSITVIDHGDRFQIRFDYGTSIYYNKRIKENA
AAIAYNAENSLFSSPVTVDVHGLLPPLPPA
Download sequence
Identical sequences A8NSH3 Q9P4R8
1uleA 000001077|e1uleA1|10.1.1.11|A:1-150 000029927|e1ulcB1|10.1.1.11|B:1-150 000029928|e1uldD1|10.1.1.11|D:1-150 000029929|e1uldC1|10.1.1.11|C:1-150 000029930|e1uldB1|10.1.1.11|B:1-150 000029931|e1ul9B1|10.1.1.11|B:1-150 000029932|e1ulcA1|10.1.1.11|A:1-150 000029933|e1ul9A1|10.1.1.11|A:1-150 000029934|e1ulgB1|10.1.1.11|B:1-150 000029935|e1ulgC1|10.1.1.11|C:1-150 000029936|e1ulfB1|10.1.1.11|B:1-150 000029937|e1ulfA1|10.1.1.11|A:1-150 000029938|e1ulgA1|10.1.1.11|A:1-150 000029939|e1ulgD1|10.1.1.11|D:1-150 000029940|e1uleB1|10.1.1.11|B:1-150 000029941|e1uldA1|10.1.1.11|A:1-150 000137841|e2wkkA1|10.1.1.11|A:1-150 000381851|e2wkkB1|10.1.1.11|B:1-150 000381852|e2wkkC1|10.1.1.11|C:1-150 000381853|e2wkkD1|10.1.1.11|D:1-150 cath|current|1ul9A00/1-150 cath|current|1ul9B00/1-150 cath|current|1ulcA00/1-150 cath|current|1ulcB00/1-150 cath|current|1uldA00/1-150 cath|current|1uldB00/1-150 cath|current|1uldC00/1-150 cath|current|1uldD00/1-150 cath|current|1uleA00/1-150 cath|current|1uleB00/1-150 cath|current|1ulfA00/1-150 cath|current|1ulfB00/1-150 cath|current|1ulgA00/1-150 cath|current|1ulgB00/1-150 cath|current|1ulgC00/1-150 cath|current|1ulgD00/1-150 cath|current|2wkkA00/1-150 cath|current|2wkkB00/1-150 cath|current|2wkkC00/1-150 cath|current|2wkkD00/1-150 d1ul9a_ d1ul9b_ d1ulca_ d1ulcb_ d1ulda_ d1uldb_ d1uldc_ d1uldd_ d1ulea_ d1uleb_ d1ulfa_ d1ulfb_ d1ulga_ d1ulgb_ d1ulgc_ d1ulgd_ d2wkka_ d2wkkb_ d2wkkc_ d2wkkd_ CC1G_05005T0 1ul9_A 1ul9_B 1ulc_A 1ulc_B 1uld_A 1uld_B 1uld_C 1uld_D 1ule_A 1ule_B 1ulf_A 1ulf_B 1ulg_A 1ulg_B 1ulg_C 1ulg_D 2wkk_A 2wkk_B 2wkk_C 2wkk_D XP_001836012.2.59657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]