SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1v0p_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1v0p_B
Domain Number 1 Region: 1-286
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.3e-98
Family Protein kinases, catalytic subunit 0.000000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1v0p_B
Sequence length 288
Comment mol:protein length:288 CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
Sequence
mekyhglekigegtygvvykaqnnygetfalkkirlekedegipsttireisilkelkhs
nivklydvihtkkrlvlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrr
vlhrdlkpqnllinregelkiadfglarafgipvrkytheivtlwyrapdvlmgskkyst
tidiwsvgcifaemvngtplfpgvseadqlmrifrilgtpnsknwpnvtelpkydpnftv
yeplpwesflkgldesgidllskmlkldpnqritakqalehayfkenn
Download sequence
Identical sequences 1ob3_A 1ob3_B 1v0p_A 1v0p_B 1ob3A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]