SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1v98_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1v98_B
Domain Number 1 Region: 53-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.46e-37
Family SCOPe 0.00029
Further Details:      
 
Domain Number 2 Region: 35-115
Classification Level Classification E-value
Superfamily CATH 1.48e-25
Family CATH 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1v98_B
Sequence length 140
Comment mol:protein length:140 thioredoxin
Sequence
MVVTCPKCGAKNRLGTPPPGQVPVCGACKTPLPWVVEADEKGFAQEVAGAPLTLVDFFAP
WCGPCRLVSPILEELARDHAGRLKVVKVNVDEHPGLAARYGVRSVPTLVLFRRGAPVATW
VGASPRRVLEERLRPYLEGR
Download sequence
Identical sequences Q5SI93
WP_011228708.1.52262 YP_144747.1.19876 300852.TTHA1481 ttk003000396.1 gi|55981450|ref|YP_144747.1| 1v98_A 1v98_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]