SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1wdc_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wdc_C
Domain Number 1 Region: 3-150
Classification Level Classification E-value
Superfamily EF-hand 5.27e-35
Family Calmodulin-like 0.00000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1wdc_C
Sequence length 156
Comment mol:protein length:156 SCALLOP MYOSIN
Sequence
pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
dvdeiikltdlqedlegnvkyedfvkkvmagpypdk
Download sequence
Identical sequences 1b7t_Z 1kk7_Z 1kqm_C 1kwo_C 1l2o_C 1qvi_Z 1s5g_Z 1sr6_C 1wdc_C 3jvt_C d3jvtc_ 1wdcC

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]