SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1wmr_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wmr_A
Domain Number 1 Region: 5-169
Classification Level Classification E-value
Superfamily Dextranase, N-terminal domain 1.24e-69
Family Dextranase, N-terminal domain 0.0000164
Further Details:      
 
Domain Number 2 Region: 191-531
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.32e-35
Family SCOPe 0.000000000693
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1wmr_A
Sequence length 549
Comment mol:protein length:549 Isopullulanase
Sequence
refmavtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpassslyydsfvy
laipgngmsdqlqytqgynqtqawtsflyshdatvkisrngssansnvvirptslnfpvr
ydnqsvyitvpysptgyrfsvefdddlislapsgarqpenallifaspfensstkpqpgs
pnsiapapgrvlglnttsastvvfnpgvyyftghdhmvlsssvtwvyfapgayvkgavef
lstasevkasghgvlsgeqyvwyadpdegyqkasgannnglrmwrgtlgnssqtfvlngv
tvsappfnsmdwsgnsldlitcrvddykqvgafygqtdglemypgtilqdvfyhtdddgl
kmyysnvtarnivmwkesvapvvefgwtprntenvlfdnvdvihqayanagnnpgifgav
nnylyapdglssnhstgnsnmtvrnitwsnfraegsssalfrinpiqnldnisiknvsie
sfeplsintteswmpvwydlnngkqitvtdfsiegftvgnttitasnaasvgridgvdpa
yagsvhyid
Download sequence
Identical sequences 1wmr_A 1wmr_B 1x0c_A 1x0c_B 2z8g_A 2z8g_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]