SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1wxr_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1wxr_A
Domain Number 1 Region: 695-1022
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.32e-35
Family Virulence factor P.69 pertactin 0.0013
Further Details:      
 
Domain Number 2 Region: 343-470,557-733
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.76e-34
Family Virulence factor P.69 pertactin 0.049
Further Details:      
 
Domain Number 3 Region: 58-119,152-244
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000017
Family Prokaryotic proteases 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1wxr_A
Sequence length 1048
Comment mol:protein length:1048 haemoglobin protease
Sequence
gtvnnelgyqlfrdfaenkgmfrpgatniaiynkqgefvgtldkaampdfsavdseigva
tlinpqyiasvkhnggytnvsfgdgenrynivdrnnapsldfhaprldklvtevaptavt
aqgavagayldkerypvfyrlgsgtqyikdsngqltkmggayswltggtvgslssyqnge
mistssglvfdyklngampiygeagdsgsplfafdtvqnkwvlvgvltagngaggrgnnw
avipldfigqkfnedndapvtfrtseggalewsfnsstgagaltqgtttyamhgqqgndl
nagknlifqgqngqinlkdsvsqgagsltfrdnytvttsngstwtgagivvdngvsvnwq
vngvkgdnlhkigegtltvqgtginegglkvgdgkvvlnqqadnkgqvqafssvniasgr
ptvvltderqvnpdtvswgyrggtldvngnsltfhqlkaadygavlannvdkratitldy
alradkvalngwsesgkgtagnlykynnpytnttdyfilkqstygyfptdqssnatwefv
ghsqgdaqklvadrfntagylfhgqlkgnlnvdnrlpegvtgalvmdgaadisgtftqen
grltlqghpvihayntqsvadklaasgdhsvltqptsfsqedwenrsftfdrlslkntdf
glgrnatlnttiqadnssvtlgdsrvfidkndgqgtaftleegtsvatkdadksvfngtv
nldnqsvlnindifnggiqannstvnissdsavlgnstltstalnlnkganalasqsfvs
dgpvnisdatlslnsrpdevshtllpvydyagswnlkgddarlnvgpysmlsgninvqdk
gtvtlggegelspdltlqnqmlyslfngyrniwsgslnapdatvsmtdtqwsmngnstag
nmklnrtivgfnggtspfttlttdnldavqsafvmrtdlnkadklvinksatghdnsiwv
nflkkpsnkdtldiplvsapeatadnlfrastrvvgfsdvtpilsvrkedgkkewvldgy
qvarndgqgkaaatfmhisynnfitevn
Download sequence
Identical sequences 1wxr_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]