SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1x6o_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1x6o_A
Domain Number 1 Region: 26-93
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 8.92e-44
Family eIF5a N-terminal domain-like 0.0015
Further Details:      
 
Domain Number 2 Region: 95-170
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.18e-24
Family Cold shock DNA-binding domain-like 0.0000958
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 1x6o_A
Sequence length 174
Comment mol:protein length:174 eukaryotic initiation factor 5a
Sequence
mahhhhhhmsdedhdfshqgggdnasktyplaagalkkggyvcingrpckvidlsvsktg
khghakvsivatdiftgnrledqapsthnvevpfvktytysvldiqanedpslpahlslm
ddegesredldmppdpalatqikeqfdsgkdvlvvvvsamgteqvlqtknaaek
Download sequence
Identical sequences Lbra003024AAA 1x6o_A 1x6oA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]