SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1xfy_S from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1xfy_S
Domain Number 1 Region: 1-146
Classification Level Classification E-value
Superfamily EF-hand 1.03e-89
Family Calmodulin-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1xfy_S
Sequence length 149
Comment mol:protein length:149 Calmodulin 2
Sequence
madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
ngtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltde
evdqmireadidgdgqvnyeefvqmmtak
Download sequence
Identical sequences 1xfu_O 1xfu_P 1xfu_Q 1xfu_R 1xfu_S 1xfu_T 1xfv_O 1xfv_P 1xfv_Q 1xfv_R 1xfv_S 1xfv_T 1xfw_O 1xfw_P 1xfw_Q 1xfw_R 1xfw_S 1xfw_T 1xfx_O 1xfx_P 1xfx_Q 1xfx_R 1xfx_S 1xfx_T 1xfy_O 1xfy_P 1xfy_Q 1xfy_R 1xfy_S 1xfy_T 1xfz_O 1xfz_P 1xfz_Q 1xfz_R 1xfz_S 1xfz_T 1xfxO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]