SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1y1x_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1y1x_A
Domain Number 1 Region: 24-185
Classification Level Classification E-value
Superfamily EF-hand 9.5e-43
Family Penta-EF-hand proteins 0.000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1y1x_A
Sequence length 191
Comment mol:protein length:191 Leishmania Major Homolog of Programmed Cell Death 6 Protein
Sequence
mahhhhhhmptstgvyapsarhmndnqelmewfravdtdgsgaisvpelnaalssagvpf
slattekllhmydknhsgeitfdefkdlhhfilsmregfrkrdssgdgrldsnevraall
ssgyqvseqtfqalmrkfdrqrrgslgfddyvelsifvcrvrnvfafydrertgqvtftf
dtfiggsvsil
Download sequence
Identical sequences Lmaj01134AAC 1y1x_A 1y1x_B cath|current|1y1xA00/10-191 cath|current|1y1xB00/11-191 1y1xA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]