SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1yhw_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1yhw_A
Domain Number 1 Region: 26-274
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.81e-88
Family Protein kinases, catalytic subunit 0.000000344
Further Details:      
 
Domain Number 2 Region: 17-97
Classification Level Classification E-value
Superfamily CATH 2.64e-17
Family CATH 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 1yhw_A
Sequence length 297
Comment mol:protein length:297 Serine/threonine-protein kinase PAK 1
Sequence
sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk
keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpeqskrstmvgtp
ywmapevvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpe
klsaifrdflnrcldmdvekrgsakellqhqflkiakplssltpliaaakeatknnh
Download sequence
Identical sequences 1yhwA 1f3m_C 1f3m_D 1yhw_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]