SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1z7q_Q from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1z7q_Q
Domain Number 1 Region: 11-240
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.45e-90
Family Proteasome subunits 0.00000000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 1z7q_Q
Sequence length 258
Comment mol:protein length:258 Proteasome component Y13
Sequence
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
TSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
KDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILV
KTGITKKDEDEEADEDMK
Download sequence
Identical sequences A0A0L8VQ09 A0A250WCG1 A6ZUE9 B3LI93 B5VJ80 C7GUG0 E7NI06 E7Q453 E7QF45 G2WEL7 N1P9W9 P23638
YGR135W YGR135W YGR135W 1z7q_C 1z7q_Q 2zcy_B 2zcy_P 3bdm_B 3bdm_P 3jco_C 3jco_c 3jcp_C 3jcp_c 3nzj_B 3nzj_P 3nzw_B 3nzw_P 3nzx_B 3nzx_P 3un4_B 3un4_P 3un8_B 3un8_P 3wxr_C 3wxr_Q 4cr2_C 4cr3_C 4cr4_C 4g4s_C 4inr_B 4inr_P 4int_B 4int_P 4inu_B 4inu_P 4j70_B 4j70_P 4jsq_B 4jsq_P 4jsu_B 4jsu_P 4jt0_B 4jt0_P 4ltc_B 4ltc_P 4nnn_B 4nnn_P 4nnw_B 4nnw_P 4no1_B 4no1_P 4no6_B 4no6_P 4no8_B 4no8_P 4no9_B 4no9_P 4q1s_B 4q1s_P 4qby_B 4qby_P 4qlq_B 4qlq_P 4qls_B 4qls_P 4qlt_B 4qlt_P 4qlu_B 4qlu_P 4qlv_B 4qlv_P 4qux_B 4qux_P 4quy_B 4quy_P 4qv0_B 4qv0_P 4qv1_B 4qv1_P 4qv3_B 4qv3_P 4qv4_B 4qv4_P 4qv5_B 4qv5_P 4qv6_B 4qv6_P 4qv7_B 4qv7_P 4qv8_B 4qv8_P 4qv9_B 4qv9_P 4qvl_B 4qvl_P 4qvm_B 4qvm_P 4qvn_B 4qvn_P 4qvp_B 4qvp_P 4qvq_B 4qvq_P 4qvv_B 4qvv_P 4qvw_B 4qvw_P 4qvy_B 4qvy_P 4qw0_B 4qw0_P 4qw1_B 4qw1_P 4qw3_B 4qw3_P 4qw4_B 4qw4_P 4qw5_B 4qw5_P 4qw6_B 4qw6_P 4qw7_B 4qw7_P 4qwf_B 4qwf_P 4qwg_B 4qwg_P 4qwi_B 4qwi_P 4qwj_B 4qwj_P 4qwk_B 4qwk_P 4qwl_B 4qwl_P 4qwr_B 4qwr_P 4qws_B 4qws_P 4qwu_B 4qwu_P 4qwx_B 4qwx_P 4qxj_B 4qxj_P 4qz0_B 4qz0_P 4qz1_B 4qz1_P 4qz2_B 4qz2_P 4qz3_B 4qz3_P 4qz4_B 4qz4_P 4qz5_B 4qz5_P 4qz6_B 4qz6_P 4qz7_B 4qz7_P 4qzw_B 4qzw_P 4qzx_B 4qzx_P 4qzz_B 4qzz_P 4r00_B 4r00_P 4r02_B 4r02_P 4r17_B 4r17_P 4r18_B 4r18_P 4rur_B 4rur_P 4x6z_C 4x6z_Q 4y69_B 4y69_P 4y6a_B 4y6a_P 4y6v_B 4y6v_P 4y6z_B 4y6z_P 4y70_B 4y70_P 4y74_B 4y74_P 4y75_B 4y75_P 4y77_B 4y77_P 4y78_B 4y78_P 4y7w_B 4y7w_P 4y7x_B 4y7x_P 4y7y_B 4y7y_P 4y80_B 4y80_P 4y81_B 4y81_P 4y82_B 4y82_P 4y84_B 4y84_P 4y8g_B 4y8g_P 4y8h_B 4y8h_P 4y8i_B 4y8i_P 4y8j_B 4y8j_P 4y8k_B 4y8k_P 4y8l_B 4y8l_P 4y8m_B 4y8m_P 4y8n_B 4y8n_P 4y8o_B 4y8o_P 4y8p_B 4y8p_P 4y8q_B 4y8q_P 4y8r_B 4y8r_P 4y8s_B 4y8s_P 4y8t_B 4y8t_P 4y8u_B 4y8u_P 4y9y_B 4y9y_P 4y9z_B 4y9z_P 4ya0_B 4ya0_P 4ya1_B 4ya1_P 4ya2_B 4ya2_P 4ya3_B 4ya3_P 4ya4_B 4ya4_P 4ya5_B 4ya5_P 4ya7_B 4ya7_P 4ya9_B 4ya9_P 4z1l_B 4z1l_P 5a5b_C 5ahj_B 5ahj_P 5bou_B 5bou_P 5bxl_B 5bxl_P 5bxn_B 5bxn_P 5cgf_B 5cgf_P 5cgg_B 5cgg_P 5cgh_B 5cgh_P 5cgi_B 5cgi_P 5cz4_B 5cz4_P 5cz5_B 5cz5_P 5cz6_B 5cz6_P 5cz7_B 5cz7_P 5cz8_B 5cz8_P 5cz9_B 5cz9_P 5cza_B 5cza_P 5d0s_B 5d0s_P 5d0t_B 5d0t_P 5d0v_B 5d0v_P 5d0w_B 5d0w_P 5d0x_B 5d0x_P 5d0z_B 5d0z_P 5dki_B 5dki_P 5dkj_B 5dkj_P 5fg7_B 5fg7_P 5fg9_B 5fg9_P 5fga_B 5fga_P 5fgd_B 5fgd_P 5fge_B 5fge_P 5fgf_B 5fgf_P 5fgg_B 5fgg_P 5fgh_B 5fgh_P 5fgi_B 5fgi_P 5fhs_B 5fhs_P 5jhr_B 5jhr_P 5jhs_B 5jhs_P 5l52_B 5l52_P 5l54_B 5l54_P 5l55_B 5l55_P 5l5a_B 5l5a_P 5l5b_B 5l5b_P 5l5d_B 5l5d_P 5l5e_B 5l5e_P 5l5f_B 5l5f_P 5l5h_B 5l5h_P 5l5i_B 5l5i_P 5l5j_B 5l5j_P 5l5o_B 5l5o_P 5l5p_B 5l5p_P 5l5q_B 5l5q_P 5l5r_B 5l5r_P 5l5s_B 5l5s_P 5l5t_B 5l5t_P 5l5u_B 5l5u_P 5l5v_B 5l5v_P 5l5w_B 5l5w_P 5l5x_B 5l5x_P 5l5y_B 5l5y_P 5l5z_B 5l5z_P 5l60_B 5l60_P 5l61_B 5l61_P 5l62_B 5l62_P 5l63_B 5l63_P 5l64_B 5l64_P 5l65_B 5l65_P 5l66_B 5l66_P 5l67_B 5l67_P 5l68_B 5l68_P 5l69_B 5l69_P 5l6a_B 5l6a_P 5l6b_B 5l6b_P 5l6c_B 5l6c_P 5lai_B 5lai_P 5laj_B 5laj_P 5ltt_B 5ltt_P 5m2b_B 5m2b_P 5mp9_C 5mp9_c 5mpa_C 5mpa_c 5mpb_C 5mpb_c 5mpc_C 5mpc_c 5nif_C 5nif_Q 5wvi_C 5wvi_d 5wvk_C 5wvk_d 6ef3_C 6g7f_B 6g7f_P 6g8m_B 6g8m_P 6g8n_B 6g8n_P 6gop_B 6gop_P 4932.YGR135W YGR135W YGR135W YGR135W YGR135W YGR135W cath|current|1z7qC00/3-245 cath|current|1z7qQ00/3-245 cath|current|2zcyB00/4-239 cath|current|2zcyP00/4-239 cath|current|3bdmB00/4-239 cath|current|3bdmP00/4-239 cath|current|3nzjB00/4-239 cath|current|3nzjP00/4-239 cath|current|3nzwB00/4-239 cath|current|3nzwP00/4-239 cath|current|3nzxB00/4-239 cath|current|3nzxP00/4-239 cath|current|3un4B00/1-244 cath|current|3un4P00/1-244 cath|current|3un8B00/1-244 cath|current|3un8P00/1-244 cath|current|3wxrC00/2-245 cath|current|3wxrQ00/2-245 cath|current|4g4sC00/6-245 cath|current|4inrB00/1-244 cath|current|4inrP00/1-244 cath|current|4intB00/1-244 cath|current|4intP00/1-244 cath|current|4inuB00/1-244 cath|current|4inuP00/1-244 cath|current|4j70B00/1-244 cath|current|4j70P00/1-244 cath|current|4jsqB00/1-244 cath|current|4jsqP00/1-244 cath|current|4jsuB00/1-244 cath|current|4jsuP00/1-244 cath|current|4jt0B00/1-244 cath|current|4jt0P00/1-244 cath|current|4ltcB00/1-244 cath|current|4ltcP00/1-244 cath|current|4nnnB00/1-244 cath|current|4nnnP00/1-244 cath|current|4nnwB00/1-244 cath|current|4nnwP00/1-244 cath|current|4no1B00/1-244 cath|current|4no1P00/1-244 cath|current|4no6B00/1-244 cath|current|4no6P00/1-244 cath|current|4no8B00/1-244 cath|current|4no8P00/1-244 cath|current|4no9B00/1-244 cath|current|4no9P00/1-244 cath|current|4q1sB00/1-244 cath|current|4q1sP00/1-244 cath|current|4qbyB00/1-244 cath|current|4qbyP00/1-244 cath|current|4qlqB00/1-244 cath|current|4qlqP00/1-244 cath|current|4qlsB00/1-244 cath|current|4qlsP00/1-244 cath|current|4qltB00/1-244 cath|current|4qltP00/1-244 cath|current|4qluB00/1-244 cath|current|4qluP00/1-244 cath|current|4qlvB00/1-244 cath|current|4qlvP00/1-244 cath|current|4r02B00/1-244 cath|current|4r02P00/1-244 cath|current|4r17B00/1-244 cath|current|4r17P00/1-244 cath|current|4r18B00/1-244 cath|current|4r18P00/1-244 cath|current|4rurB00/1-244 cath|current|4rurP00/1-244 NP_011651.3.97178 YGR135W YGR135W YGR135W YGR135W YGR135W tr|A6ZUE9|A6ZUE9_YEAS7 YGR135W YGR135W YGR135W YGR135W 2zcyB YGR135W SCRT_00883 YGR135W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]