SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2arj_H from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2arj_H
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily Immunoglobulin 5.09e-47
Family V set domains (antibody variable domain-like) 0.0000104
Further Details:      
 
Domain Number 2 Region: 122-214
Classification Level Classification E-value
Superfamily Immunoglobulin 5.07e-22
Family C1 set domains (antibody constant domain-like) 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2arj_H
Sequence length 215
Comment mol:protein length:215 YTS 105.18 antigen binding region Heavy chain
Sequence
qvqlkesgpglvqpsqtlsltctvsgfsltsnsvhwvrqppgkglewmggiwgdgdtdyn
salksrlsisrdtsknqvflkmnslqtddtaiyfctpligswyfdfwgpgtmvtassaqt
tapsvyplapgcgdttsstvtlgclvkgyfpepvtvtwnsgalssdvhtfpavlqsglyt
ltssvtsstwpsqtvtcnvahpasstkvdqkivpr
Download sequence
Identical sequences 2arjB 2arj_B 2arj_H

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]