SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2bds_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2bds_A
Domain Number 1 Region: 1-43
Classification Level Classification E-value
Superfamily Defensin-like 2.02e-21
Family Defensin 0.0000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2bds_A
Sequence length 43
Comment mol:protein length:43 BDS-I
Sequence
AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH
Download sequence
Identical sequences P11494
1bds_A 2bds_A 1bdsA 000008286|e1bdsA1|383.1.1.3|A:1-43 000090407|e2bdsA1|383.1.1.3|A:1-43 cath|current|1bdsA00/1-43 cath|current|2bdsA00/1-43 d1bdsa_ d2bdsa_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]