SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2dsa_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2dsa_C
Domain Number 1 Region: 84-198
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.91e-41
Family SCOPe 0.0000315
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.64e-24
Family SCOPe 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2dsa_C
Sequence length 203
Comment mol:protein length:203 Glutathione S-transferase
Sequence
MKLYYSPGACSLSPHIALREAGLNFELVQVDLASKKTASGQDYLEVNPAGYVPCLQLDDG
RTLTEGPAIVQYVADQVPGKQLAPANGSFERYHLQQWLNFISSELHKSFSPLFNPASSDE
WKNAVRQSLNTRLGQVARQLEHAPYLLGDQLSVADIYLFVVLGWSAYVNIDLSPWPSLQA
FQGRVGGREAVQSALRAEGLIKE
Download sequence
Identical sequences Q8GBY1
2dsa_A 2dsa_B 2dsa_C 2dsa_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]