SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2fa8_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2fa8_B
Domain Number 1 Region: 7-89
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.07e-57
Family Selenoprotein W-related 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2fa8_B
Sequence length 105
Comment mol:protein length:105 hypothetical protein Atu0228
Sequence
ghmtetkpriairyctqcnwllragwmaqeilqtfasdigevslipstgglfeitvdgti
iwerkrdggfpgpkelkqrirdlidperdlghvdrtkhegldtgs
Download sequence
Identical sequences 2fa8_A 2fa8_B 2fa8_C 2fa8_D 2fa8A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]