SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2gbr_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2gbr_C
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.38e-64
Family Ubiquitin-related 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2gbr_C
Sequence length 81
Comment mol:protein length:81 Ubiquitin
Sequence
mqifvktltgktitlevepsdtienvkakiqdkegrwalaippdqqrlifagkqledgrt
lsdyniqkestlhlvlrlrgg
Download sequence
Identical sequences cath|current|2gbrA00/1-77 cath|current|2gbrB00/1-77 cath|current|2gbrC00/1-76 2gbr_A 2gbr_B 2gbr_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]