SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2gez_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2gez_B
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 9.64e-44
Family (Glycosyl)asparaginase 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2gez_B
Sequence length 133
Comment mol:protein length:133 L-asparaginase beta subunit
Sequence
tvgcvavdshgnlasatstgglvnkmvgrigdtpligagtyanelcavsatgkgeeiira
tvardvaalmefkglslkeaadfvihertpkgtvgliavsaageiampfnttgmfracat
edgyseiaiwptt
Download sequence
Identical sequences 2gez_B 2gez_D 2gez_F 2gez_H cath|current|2gezB00/193-325 cath|current|2gezD00/193-325 cath|current|2gezF00/193-325 cath|current|2gezH00/193-325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]