SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2h01_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2h01_A
Domain Number 1 Region: 5-190
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.66e-99
Family Glutathione peroxidase-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2h01_A
Sequence length 192
Comment mol:protein length:192 2-CYS PEROXIREDOXIN
Sequence
afqgqapsfkaeavfgdntfgevslsdfigkkyvllyfypldftfvcpseiialdkalds
fkernvellgcsvdskfthlawkktplsqggignikhtlisdisksiarsydvlfnesva
lrafvlidkqgvvqhllvnnlalgrsvdeilrlidalqhhekygdvcpanwqkgkesmkp
seegvakylsnl
Download sequence
Identical sequences 2h01A 2h01_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]