SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2hze_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2hze_A
Domain Number 1 Region: 9-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.15e-22
Family SCOPe 0.0000401
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2hze_A
Sequence length 114
Comment mol:protein length:114 Glutaredoxin-1
Sequence
hhhhhqmaeefvqqrlannkvtifvkytcpfcrnaldilnkfsfkrgayeivdikefkpe
nelrdyfeqitggktvpriffgktsiggysdlleidnmdalgdilssigvlrtc
Download sequence
Identical sequences 2hze_A 2hze_B 2hzf_A 2hzf_B cath|current|2hzeA00/-2-107 cath|current|2hzfA00/-2-107 cath|current|2hzfB00/-1-107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]