SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2i2s_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2i2s_A
Domain Number 1 Region: 4-163
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.04e-123
Family vp4 sialic acid binding domain 0.00000824
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2i2s_A
Sequence length 163
Comment mol:protein length:163 Outer capsid protein VP4
Sequence
gslldgpyqpttfnpptsywillaptvegvviqgtnnidrwlatiliepnvqttnriynl
fgqqvtlsventsqtqwkfidvskttptgnytqhgslfstpklyavmkfsgriytyngtt
pnattgyysttnydtvnmtsfcdfyiiprnqeekcteyinhgl
Download sequence
Identical sequences 000153127|e3tayA1|10.1.1.173|A:1-163 000163942|e2i2sA1|10.1.1.173|A:1-163 000317455|e2i2sB1|10.1.1.173|B:1-163 000990701|e3tayB1|10.1.1.173|B:1-163 cath|current|2i2sA00/62-224 cath|current|2i2sB00/62-224 cath|current|3tayA00/62-224 cath|current|3tayB00/62-224 2i2s_A 2i2s_B 3tay_A 3tay_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]