SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2iq7_G from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2iq7_G
Domain Number 1 Region: 24-332
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.12e-115
Family Galacturonase 0.000000000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2iq7_G
Sequence length 339
Comment mol:protein length:339 endopolygalacturonase
Sequence
asctftdaaaaikgkasctsiilngivvpagttldmtglksgttvtfqgkttfgykeweg
plisfsgtniningasghsidcqgsrwwdskgsnggktkpkffyahslkssnikglnvln
tpvqafsinsattlgvydviidnsagdsagghntdafdvgsstgvyisganvknqddcla
insgtnitftggtcsgghglsigsvggrsdntvktvtisnskivnsdngvriktvsgatg
svsgvtysgitlsniakygivieqdyengsptgtptngvpitgltlskitgsvassgtnv
yilcasgacsnwkwsgvsvtggkkstkcsnipsgsgaac
Download sequence
Identical sequences 2iq7_A 2iq7_B 2iq7_C 2iq7_D 2iq7_E 2iq7_F 2iq7_G 000166049|e2iq7A1|207.2.1.8|A:1-339 000329821|e2iq7B1|207.2.1.8|B:1-339 000329822|e2iq7C1|207.2.1.8|C:1-339 000329823|e2iq7D1|207.2.1.8|D:1-339 000329824|e2iq7E1|207.2.1.8|E:1-339 000329826|e2iq7G1|207.2.1.8|G:1-339 cath|current|2iq7A00/24-362 cath|current|2iq7B00/24-362 cath|current|2iq7C00/24-362 cath|current|2iq7D00/24-362 cath|current|2iq7E00/24-362 cath|current|2iq7F00/25-362 cath|current|2iq7G00/24-362 d2iq7a_ d2iq7b_ d2iq7c_ d2iq7d_ d2iq7e_ d2iq7g_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]