SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2kzw_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2kzw_A
Domain Number 1 Region: 54-139
Classification Level Classification E-value
Superfamily PKD domain 6.59e-22
Family PKD domain 0.00046
Further Details:      
 
Domain Number 2 Region: 6-49
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000319
Family Pectin lyase 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2kzw_A
Sequence length 145
Comment mol:protein length:145 Uncharacterized protein
Sequence
mnardnkfntwndsrgnywsdyegsdengdgigdsayavnpeagsmdymplmeylhsspv
lptarftsditegfaplsvrfkdfsenatsrlwmfgdgntsdspsplhtffnegeyivsl
ivsnendsdsasvtiralehhhhhh
Download sequence
Identical sequences 2kzw_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]