SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2lp3_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2lp3_B
Domain Number 1 Region: 2-90
Classification Level Classification E-value
Superfamily EF-hand 1.74e-25
Family S100 proteins 0.0000821
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2lp3_B
Sequence length 93
Comment mol:protein length:93 Protein S100-A1
Sequence
gseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdvdavdkvmke
ldengdgevdfqeyvvlvaaltvacnnffwens
Download sequence
Identical sequences 2llt_A 2llt_B 2llu_A 2llu_B 2lp2_A 2lp2_B 2lp3_A 2lp3_B 000152665|e2lltA1|108.1.1.8|A:1-93 000180697|e2l0pA1|108.1.1.8|A:2-94 000223009|e2lp2A1|108.1.1.8|A:1-93 000417396|e2l0pB1|108.1.1.8|B:2-94 000977124|e2lp3A1|108.1.1.8|A:1-93 000977125|e2lluB1|108.1.1.8|B:1-93 000977127|e2lp2B1|108.1.1.8|B:1-93 000977128|e2lluA1|108.1.1.8|A:1-93 000977129|e2lltB1|108.1.1.8|B:1-93 000977130|e2lp3B1|108.1.1.8|B:1-93 d2l0pa_ d2l0pb_ d2llta_ d2lltb_ d2llua_ d2llub_ d2lp2a_ d2lp2b_ d2lp3a_ d2lp3b_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]