SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ltn_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ltn_A
Domain Number 1 Region: 6-181
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.92e-59
Family Legume lectins 0.00000836
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2ltn_A
Sequence length 181
Comment mol:protein length:181 PEA LECTIN, ALPHA CHAIN
Sequence
tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
n
Download sequence
Identical sequences 2ltnA 1bqp_A 1bqp_C 1hkd_A 1hkd_C 2ltn_A 2ltn_C cath|current|1bqpA00/1-181 cath|current|1bqpC00/1-181 cath|current|1hkdA00/1-181 cath|current|1hkdC00/1-181 cath|current|2ltnA00/1-181 cath|current|2ltnC00/1-181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]