SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2ndo_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ndo_A
Domain Number 1 Region: 2-187
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.37e-46
Family DsbA-like 0.00000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2ndo_A
Sequence length 189
Comment mol:protein length:189 Thiol:disulfide interchange protein DsbA
Sequence
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsekk
Download sequence
Identical sequences A0A0H2UL03
cath|current|1a23A00/1-189 cath|current|1a24A00/1-189 cath|current|1a2jA00/1-188 cath|current|1a2lA00/3-188 cath|current|1a2lB00/3-188 cath|current|1a2mA00/1-188 cath|current|1a2mB00/1-188 cath|current|1dsbA00/1-188 cath|current|1dsbB00/1-188 cath|current|1fvkA00/1-188 cath|current|1fvkB00/1-188 d1a23a_ d1a24a_ d2ndoa_ 1fvkA 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2l_B 1a2m_A 1a2m_B 1dsb_A 1dsb_B 1fvk_A 1fvk_B 2ndo_A 4wet_A 4wet_B 4wey_A 4wey_B 4wf4_A 4wf4_B 4wf5_A 4wf5_B 6bqx_A 6bqx_B 6br4_A 6br4_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]