SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2nlb_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2nlb_B
Domain Number 1 Region: 1-36
Classification Level Classification E-value
Superfamily Defensin-like 6.55e-20
Family Defensin 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2nlb_B
Sequence length 36
Comment mol:protein length:36 Beta-defensin 1
Sequence
dhyacvssggqclysacpiftkiqgtcyrgkakcck
Download sequence
Identical sequences 2nlb_A 2nlb_B 2nlb_C 2nlb_D 000162447|e2nlbA1|383.1.1.4|A:1-36 000309095|e2nlbB1|383.1.1.4|B:1-36 000309096|e2nlbC1|383.1.1.4|C:1-36 000309097|e2nlbD1|383.1.1.4|D:1-36 d2nlba_ d2nlbb_ d2nlbc_ d2nlbd_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]