SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2nn6_H from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2nn6_H
Domain Number 1 Region: 183-306
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.78e-41
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000253
Further Details:      
 
Domain Number 2 Region: 89-181
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.13e-26
Family Cold shock DNA-binding domain-like 0.0000068
Further Details:      
 
Domain Number 3 Region: 40-89
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.000000000006
Family ECR1 N-terminal domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2nn6_H
Sequence length 308
Comment mol:protein length:308 Exosome complex exonuclease RRP4
Sequence
mgsshhhhhhsqdphmamemrlpvarkplserlgrdtkkhlvvpgdtittdtgfmrghgt
ymgeekliasvagsvervnklicvkalktryigevgdivvgritevqqkrwkvetnsrld
svlllssmnlpggelrrrsaedelamrgflqegdlisaevqavfsdgavslhtrslkygk
lgqgvlvqvspslvkrqkthfhdlpcgasvilgnngfiwiyptpehkeeeaggfianlep
vsladrevisrlrnciislvtqrmmlydtsilycyeaslphqikdilkpeimeeivmetr
qrlleqeg
Download sequence
Identical sequences 2nn6_H 2nn6H

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]