SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2o0w_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2o0w_A
Domain Number 1 Region: 2-398
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.42e-85
Family Pectate lyase-like 0.00000000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2o0w_A
Sequence length 399
Comment mol:protein length:399 Pectate lyase
Sequence
adlghqtlgsndgwgaystgttggskasssnvytvsnrnqlvsalgketnttpkiiyikg
tidmnvddnlkplglndykdpeydldkylkaydpstwgkkepsgtqeeararsqknqkar
vmvdipanttivgsgtnakvvggnfqiksdnviirniefqdaydyfpqwdptdgssgnwn
sqydnitinggthiwidhctfndgsrpdstspkyygrkyqhhdgqtdasnganyitmsyn
yyhdhdkssifgssdsktsddgklkitlhhnryknivqaaprvrfgqvhvynnyyegsts
sssypfsyawgigksskiyaqnnvidvpglsaaktisvfsggtalydsgtllngtqinas
aanglsssvgwtpslhgsidasanvksnvinqagagkln
Download sequence
Identical sequences 000166269|e2nzmA1|207.2.1.15|A:1-399 000331619|e2o04A1|207.2.1.15|A:1-399 000331620|e2o0vA1|207.2.1.15|A:1-399 000331621|e2o0wA1|207.2.1.15|A:1-399 000331622|e2o17A1|207.2.1.15|A:1-399 000331623|e2o1dA1|207.2.1.15|A:1-399 cath|current|2nzmA00/1-399 cath|current|2o04A00/1-399 cath|current|2o0vA00/1-399 cath|current|2o0wA00/1-399 cath|current|2o17A00/1-399 cath|current|2o1dA00/1-399 d2nzma_ d2o04a_ d2o0va_ d2o0wa_ d2o17a_ d2o1da_ 2nzm_A 2o04_A 2o0v_A 2o0w_A 2o17_A 2o1d_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]