SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2p6k_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2p6k_A
Domain Number 1 Region: 1-262
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 3.72e-64
Family Tetrapyrrole methylase 0.000000000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2p6k_A
Sequence length 265
Comment mol:protein length:265 diphthine synthase
Sequence
MVLYFIGLGLYDERDITVKGLEIAKKCDYVFAEFYTSLMAGTTLGRIQKLIGKEIRVLSR
EDVELNFENIVLPLAKENDVAFLTPGDPLVATTHAELRIRAKRAGVESYVIHAPSIYSAV
GITGLHIYKFGKSATVMYPEGNWFPTSYYDVIKENAERGLHTLLFLDIKAEKRMYMTANE
AMELLLKVEDMKKGGVFTDDTLVVVLARAGSLNPTIRAGYVKDLIREDFGDPPHILIVPG
KLHIVEAEYLVEIAGAPREILRVNV
Download sequence
Identical sequences 2p6k_A 2p6k_B pho001000725.51 d2p6ka_ d2p6kb_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]