SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2qa4_I from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2qa4_I
Domain Number 1 Region: 4-80
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.98e-20
Family Ribosomal L11/L12e N-terminal domain 0.0016
Further Details:      
 
Domain Number 2 Region: 64-136
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 6.52e-20
Family Ribosomal protein L11, C-terminal domain 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2qa4_I
Sequence length 162
Comment mol:protein length:162 50S ribosomal protein L11P
Sequence
MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDG
SFEIEVGVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNA
AKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEAQA
Download sequence
Identical sequences P14122
gi|55378198|ref|YP_136048.1| 1vqoI 272569.rrnAC1414 WP_011223608.1.69175 1s72_I 1vq4_I 1vq5_I 1vq6_I 1vq7_I 1vq8_I 1vq9_I 1vqk_I 1vql_I 1vqm_I 1vqn_I 1vqo_I 1vqp_I 1yhq_I 1yi2_I 1yij_I 1yit_I 1yj9_I 1yjn_I 1yjw_I 2otl_I 2qa4_I 2qex_I 3cc2_I 3cc4_I 3cc7_I 3cce_I 3ccj_I 3ccl_I 3ccm_I 3ccq_I 3ccr_I 3ccs_I 3ccu_I 3ccv_I 3cd6_I 3cma_I 3cme_I 3i55_I 3i56_I 4v9f_I

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]